top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|70296129|70306290|—|3|circRNA|ANKRD13C|NM_030816|8,7,6

ANKRD13C

Open Reading Frame (ORF)

LQLYQQNQFLSRVPRQDGFFGKIKHAFTFPNSAFRCM

Peptide

IKHAFTFPNSAFR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page