top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|6528993|6533441|—|4|circRNA|NOL9|ENST00000377705.5|10,9,8,7

NOL9

Open Reading Frame (ORF)

LVFARSRMTSEDTRMGPSCLPRLQSVTAWALDHLSLT

Peptide

LQSVTAWALDHLSLT

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page