top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|64869310|64879148|—|3|circRNA|JAK1|NM_002227|6,5,4

JAK1

Open Reading Frame (ORF)

LVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPELPKDIRYLSSLSQPLCPV

Peptide

MQLPELPKDIR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page