top of page

CircRNA

Gene

chr1|64781379|64814840|+|8|circRNA|RAVER2|ENST00000294428.7|4,5,6,7,8,9,10,11

RAVER2

CircRNA UID

circRAVER2(4,5,6,7,8,9,10,11)

Open Reading Frame (ORF)

LQVKPLFIRLELQAAFWMQSLREVNHNTHWKSALLILHLLVIMHSLHRMKVVTLVALQWLNIALRSRLKRSSRQQTV

Peptide

VVTLVALQWLNIALR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page