top of page

CircRNA

Gene

chr1|62037976|62084648|+|4|circRNA|INADL|ENST00000316485.10|30,31,32,33

INADL

CircRNA UID

circINADL(30,31,32,33)

Open Reading Frame (ORF)

LSVDPATCPIVPGQEMIIEISKGRSGLGLSIVGGKDTPLKRGCSQSDGRYSLSSAIKFSIFY

Peptide

RGCSQSDGR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page