top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|5907114|5986327|—|12|circRNA|NPHP4|NM_015102|13,12,11,10,9,8,7,6,5,4,3,2

NPHP4

Open Reading Frame (ORF)

MALRPPRPRQSSGKPTGPSGGQDERLAQDLHPKRACPSPPTESAPALEGIHGIPVCPQVAGRTGN

Peptide

SSGKPTGPSGGQDERLAQDLHPK

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page