top of page

CircRNA

Gene

chr1|58506059|58534331|—|5|circRNA|OMA1|ENST00000421528.6|7,6,5,4,3

OMA1

Open Reading Frame (ORF)

LIACMANPRCQNGYLHTLLMAIELSTWIDLYLSGWKNLKMIC

Peptide

LIACMANPRCQNGYLHTLLMAIELSTWIDLYLSGWK

ORF Found in Long-Read

false

Peptide Length

36

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

32

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page