top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|58506059|58530729|—|3|circRNA|OMA1|ENST00000421528.6|7,6,5

OMA1

Open Reading Frame (ORF)

LIACMANPRCQNGYLHTLLMAIELSTWIDLYLRQKRLAWFICWIS

Peptide

LIACMANPR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page