top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|56787174|56792803|-|3|circRNA|C1orf168|ENST00000343433.6|4,3,2

C1orf168

Open Reading Frame (ORF)

LPTMEVRPSIWKGKKAWGLLQRNPGKSWKQKEPRLFLPRSTWWPPKYYITSLKIPLL

Peptide

AWGLLQR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page