top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|45640209|45661225|—|6|circRNA|GPBP1L1|ENST00000290795.7|7,6,5,4,3,2

GPBP1L1

Open Reading Frame (ORF)

LLLPSLLHSPHQDLTMQMGTNCHPWFQVSIRTWFLSLYHLLPRVIDSCGLSNDCEVVEMDPK

Peptide

VIDSCGLSNDCEVVEMDPK

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page