top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|45457563|45457871|—|1|circRNA|TESK2|ENST00000372086.3|2

TESK2

Open Reading Frame (ORF)

MDRSKRNSIAGFPPRVERLEEFEGGGGGEGNVSQVGRVWPSSYRALISAFSRLTRLDDFTCEKIGSGFFSEVFKCQTRREVKFNKNLCVEFLLKRRKK

Peptide

IGSGFFSEVFKCQTR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page