top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|43692311|43693971|+|1|ciRNA|KDM4A|NM_014663|16

KDM4A

Open Reading Frame (ORF)

LGRGRERAVITGRLGHSRGRFQEALGSYGKEVCIELSSLFSLPETCHTPLACSSVHFSTEWCKKHDPVLT

Peptide

GRFQEALGSYGK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page