top of page

CircRNA

Gene

chr1|43653136|43689095|+|12|circRNA|KDM4A|NM_014663|2,3,4,5,6,7,8,9,10,11,12,13

KDM4A

Open Reading Frame (ORF)

LTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIFQTYHQIPV

Peptide

EFNETMAQQAPHCAVCMIFQTYHQIPV

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page