top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|43617444|43620579|+|8|circRNA|PTPRF|ENST00000359947.8|24,25,26,27,28,29,30,31

PTPRF

Open Reading Frame (ORF)

LLATSTLLLTRWLSTTCPSISCVSSRSRMPGPSTLDSSSRGRIQTWR

Peptide

SRMPGPSTLDSSSR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page