top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|39853969|39876132|—|3|circRNA|TRIT1|ENST00000486825.6|4,3,2

TRIT1

Open Reading Frame (ORF)

LKIYLPETKFLLLWEEPIITLNLCSGKFLSIPSFGFLRNLNQTRTLLAS

Peptide

FLSIPSFGFLRNLNQTR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page