top of page

CircRNA

Gene

chr1|39447431|39448763|+|4|circRNA|MACF1|ENST00000567887.5|81,82,83,84

MACF1

CircRNA UID

circMACF1(81,82,83,84)

Open Reading Frame (ORF)

LKEKTLLPEDSQKLDNFLGEVRDKWDTVCGKSVERQSWKRPSTWQQNSRIPYKNLSTGSL

Peptide

IPYKNLSTGSL

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page