top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|39284065|39310428|+|16|circRNA|MACF1|ENST00000567887.5|10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25

MACF1

Open Reading Frame (ORF)

LQDSRDSVLFSVADRLRLEEEVEACKARFQHLMKSMENGSGLQVARIPKPSGLPHSLDQTAYNTDVR

Peptide

FQHLMKSMENGSGLQVAR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page