top of page

CircRNA

Gene

chr1|38915561|38919337|—|2|circRNA|RHBDL2|NM_001304746|3,2

RHBDL2

Open Reading Frame (ORF)

LAVFIYYAVWKPQKQWITLDTGILESPFIYSPEKREEAWRFISYMLVHAGKGLGKQSLRQTAQGRAAA

Peptide

QTAQGRAAA

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page