top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|37864311|37866543|—|3|circRNA|INPP5B|ENST00000373027.5|17,16,15

INPP5B

Open Reading Frame (ORF)

LMAFLRELLKNSAKNHLDENILGRSVSATRPEVRI

Peptide

NSAKNHLDENILGR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page