top of page

CircRNA

Gene

chr1|37723040|37727210|-|3|circRNA|EPHA10|ENST00000432874.7|4,3,2

EPHA10

CircRNA UID

circEPHA10(4,3,2)

Open Reading Frame (ORF)

LCICSPRNWMRKASRWRGALEELPQGPGTRAPPLSSP

Peptide

GALEELPQGPGTR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

TCGA,PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page