top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|3631465|3633503|—|3|circRNA|WRAP73|ENST00000270708.11|11,10,9

WRAP73

Open Reading Frame (ORF)

LRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGGV

Peptide

LYLWSPAGCMSVQVPGEGGV

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page