top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|36282532|36289764|+|3|circRNA|THRAP3|NM_005119|3,4,5

THRAP3

Open Reading Frame (ORF)

LILLLPKLILRSLFGAVSLPKGISSEMTLRRRWLTSTRRRWMIKIRTKLREERNLSLMMNPNLCLKS

Peptide

WLTSTRR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page