top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|35442905|35507135|—|16|circRNA|KIAA0319L|ENST00000325722.7|18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3

KIAA0319L

Open Reading Frame (ORF)

LGEKITSGFLKEPPLSSHVGLPAARTLPAMSFGG

Peptide

ITSGFLK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page