top of page

CircRNA

Gene

chr1|35014696|35030713|-|5|circRNA|RP11-244H3.4|ENST00000487874.1|6,5,4,3,2

RP11-244H3.4

CircRNA UID

circRP11-244H3.4(6,5,4,3,2)

Open Reading Frame (ORF)

MNCCENCGSYCYSSSGPCQSQKVFSSTSVTAYKQVSNYPLPRRNLFV

Peptide

VFSSTSVTAYKQVSNYPLPR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page