top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|33354400|33355253|—|2|circRNA|PHC2|ENST00000431992.5|7,6

PHC2

Open Reading Frame (ORF)

LMTGKKWHQGRKVCLRRGLAHHHISRLLSLPCLVACLYPRALTSSRPQLTPMLSCSHTSSSHSHPQSTCSPNL

Peptide

RGLAHHHISR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page