top of page

CircRNA

Gene

chr1|31730799|31742217|-|22|circRNA|ADGRB2|NM_001294335|29,28,27,26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8

ADGRB2

Open Reading Frame (ORF)

LAVGVEVVRMPPGPGRRGPPGELPRQWPTLKATPASCPWTTRAWGWALPMDLSRIPME

Peptide

LAVGVEVVRMPPGPGR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page