top of page

CircRNA

Gene

chr1|31425913|31426652|+|1|ciRNA|SERINC2|ENST00000373710.5|6

SERINC2

CircRNA UID

ciSERINC2(6)

Open Reading Frame (ORF)

LVLSVLNTTRRKAHLGAVWFPHLPRLASISQTGRAGQQPVPRSVFARLF

Peptide

LASISQTGR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page