top of page

CircRNA

Gene

chr1|30945345|30953981|-|4|circRNA|PUM1|ENST00000424085.6|14,13,12,11

PUM1

CircRNA UID

circPUM1(14,13,12,11)

Open Reading Frame (ORF)

MAITWFRNALNVYSPSLCNLSSMRLRDRRTHEWQWKIHLCCSRR

Peptide

MAITWFR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page