top of page

CircRNA

Gene

chr1|28683585|28697084|+|5|circRNA|GMEB1|NM_024482|2,3,4,5,6

GMEB1

CircRNA UID

circGMEB1(2,3,4,5,6).A

Open Reading Frame (ORF)

MMDSGQIDFYQHDKVCSNTCRSTKFDLLISSARAPVPGQQTSVVQTPTSADVPAI

Peptide

APVPGQQTSVVQTPTSADVPAI

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page