top of page

CircRNA

Gene

chr1|28460211|28466768|+|3|circRNA|PHACTR4|NM_001048183|4,5,6

PHACTR4

CircRNA UID

circPHACTR4(4,5,6)

Open Reading Frame (ORF)

LEASLILKQSLFLRMYPNHLYFLPKDPCPLLMKQVKGKQRMPLPLAARQGSSSPPPSPQHPLPPLLPQALQRLLISLSPLPQHPGLCLLLLPALTLLLPQASLIWSLPSSPLSLPLNQLTEIATLSLF

Peptide

MPLPLAAR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page