top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|248850681|248855946|—|5|circRNA|ZNF692|NM_001136036|11,10,9,8,7

ZNF692

Open Reading Frame (ORF)

LSSTDVSTLEKNPCIVSLMPPDYCLPLSPAHLKRGRHHQPLQHSPVLLLCRPCQHPH

Peptide

LSSTDVSTLEK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page