top of page

CircRNA

Gene

chr1|246898207|246918377|-|11|circRNA|AHCTF1|ENST00000366508.5|12,11,10,9,8,7,6,5,4,3,2

AHCTF1

CircRNA UID

circAHCTF1(12,11,10,9,8,7,6,5,4,3,2)

Open Reading Frame (ORF)

LTFLKKSGPSLNELIPDGYNRCLVAGLLSPRFVDVQPSSLSQWKYARLKSSSD

Peptide

FVDVQPSSLSQWKYAR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page