top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|237530426|237569319|+|5|circRNA|RYR2|ENST00000366574.6|25,26,27,28,29

RYR2

Open Reading Frame (ORF)

MVKSFLMIQAQNWLSRTLMLAMDFVGIRMSCGYIR

Peptide

TLMLAMDFVGIR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page