top of page

CircRNA

Gene

chr1|235454155|235455684|—|2|circRNA|B3GALNT2|NM_152490|10,9

B3GALNT2

Open Reading Frame (ORF)

MWVRICDLQGHRQVAGKQLGEVKDLSGLWKQRASICC

Peptide

MWVRICDLQGHR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page