top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|232425588|232461161|—|9|circRNA|SIPA1L2|ENST00000366630.5|17,16,15,14,13,12,11,10,9

SIPA1L2

Open Reading Frame (ORF)

LEGWPSPREPPRGDLQSSRGHSDPRADDRPAPYFCDCEGGHHPAP

Peptide

GDLQSSRGHSDPR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page