top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|230843353|230843896|—|1|circRNA|C1orf198|NM_001136495|3

C1orf198

Open Reading Frame (ORF)

LSRPSAVHCTRLPPPSSRGSCHLLMSGRTMGKTPCSRNPSLHRVRWSSVSPPYPSRSRATAPPPASPDHCPKLPRAPRPSSPPKAAGPPAWTPWAPPGRRRKRHSGRSMLSGPEGRGLRPSSSR

Peptide

ATAPPPASPDHCPKLPR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page