top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|229460610|229475732|-|7|circRNA|NUP133|ENST00000261396.5|20,19,18,17,16,15,14

NUP133

Open Reading Frame (ORF)

LEKGKRGKLLSQPISQHGQLANFLQAHEHLSWLHEINSQELEKKHLGSAIRH

Peptide

HLGSAIR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA,PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page