top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|229458160|229460769|—|2|circRNA|NUP133|ENST00000261396.5|21,20

NUP133

Open Reading Frame (ORF)

LGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEFFRLSLPLVSGERKARQIIISAHFSAWTVGKFFASS

Peptide

IEEFFRLSLPLVSGER

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page