top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|228213440|228245688|+|10|circRNA|OBSCN|ENST00000284548.15|3,4,5,6,7,8,9,10,11,12

OBSCN

Open Reading Frame (ORF)

LHTKAGSAAGGQSRCWGVQLRGWGPESLLSTAHHRARGSLQKAAARSGGAGEGVGHVPM

Peptide

AGSAAGGQSR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page