top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|227112311|227147559|—|7|circRNA|CDC42BPA|ENST00000366767.7|13,12,11,10,9,8,7

CDC42BPA

Open Reading Frame (ORF)

LKSFKPWKMEKGDMDLNVTGGLWGSVCMKCFTEKHHFMQNRWWRHTEKS

Peptide

GDMDLNVTGGLWGSVCMKCFTEK

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page