top of page

CircRNA

Gene

chr1|227023262|227029250|-|3|circRNA|CDC42BPA|ENST00000366767.7|30,29,28

CDC42BPA

CircRNA UID

circCDC42BPA(30,29,28)

Open Reading Frame (ORF)

MEKEIHTVCSIQMTIHYHLLHINQWMLSAQLRSPVKNICCVLTALGYTLTARAEDLDNRN

Peptide

AEDLDNR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page