top of page

CircRNA

Gene

chr1|223543107|223616145|—|11|circRNA|CAPN8|ENST00000366872.9|20,19,18,17,16,15,14,13,12,11,10

CAPN8

Open Reading Frame (ORF)

LDEDKDGMVQLSLAEPRTGPIPSSKSVWMKWMRTRRRASVNPAVQCCWA

Peptide

DGMVQLSLAEPR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page