top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|220184035|220191284|-|6|circRNA|RAB3GAP2|NM_012414|19,18,17,16,15,14

RAB3GAP2

Open Reading Frame (ORF)

LLQFCANKLKLLQLYESVSQLNSLDFHLDTPFSDNGTATHKLDGFKL

Peptide

LKLLQLYESVSQLNSLDFHLDTPFSDNGTATHK

ORF Found in Long-Read

false

Peptide Length

33

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

27

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page