top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|220102128|220103562|+|5|circRNA|IARS2|ENST00000366922.2|4,5,6,7,8

IARS2

Open Reading Frame (ORF)

LLLLLWKQHLRLFQHFQLDHLLKQPLRNRNQHLFVGE

Peptide

LFQHFQLDHLLKQPLR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page