top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|214372710|214386922|—|5|circRNA|PTPN14|ENST00000366956.9|16,15,14,13,12

PTPN14

Open Reading Frame (ORF)

MALHSHPGAPATHVPRLLADGVGAGSECDCHGHCRGAQAAAVHPASRSRPVW

Peptide

GAQAAAVHPASR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page