top of page

CircRNA

Gene

chr1|214305186|214334308|+|9|circRNA|SMYD2|ENST00000491455.5|2,3,4,5,6,7,8,9,10

SMYD2

CircRNA UID

circSMYD2(2,3,4,5,6,7,8,9,10)

Open Reading Frame (ORF)

MDRKSLSPTGDCRGCSNHPRSGIWLFRMYTIVSSSCPLLRLA

Peptide

MYTIVSSSCPLLRLA

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page