top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|20765376|20773610|—|4|circRNA|HP1BP3|ENST00000312239.9|8,7,6,5

HP1BP3

Open Reading Frame (ORF)

MSSHWPLLAFVNLKKLPTVSSGNMCLSIILSLEWTSVRKISLKKRRRK

Peptide

MSSHWPLLAFVNLK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page