top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|20747543|20749882|—|2|circRNA|HP1BP3|ENST00000312239.9|11,10

HP1BP3

Open Reading Frame (ORF)

MGGWNRSLGKGSVAPSSSVFPIIPAEEIRGETPAWWKPDGICNLVCHCCHE

Peptide

GSVAPSSSVFPIIPAEEIR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page