top of page

CircRNA

Gene

chr1|205308792|205311704|-|1|ciRNA|NUAK2|ENST00000367157.4|2

NUAK2

Open Reading Frame (ORF)

LIASVYKALCMRPCPGSSGWKSEMVMDISALPGAL

Peptide

LIASVYK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page