top of page

CircRNA

Gene

chr1|205163722|205169832|-|2|circRNA|DSTYK|NM_015375|4,3

DSTYK

Open Reading Frame (ORF)

MHSTKMNSLRGMSKSFRKSESISPFLYSFSKCRNWARR

Peptide

GMSKSFR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page